NRGN, 1-78aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
NRGN, also known as Neurogranin, is a calmodulin-binding protein expressed exclusively in the brain, particularly in dendritic spines, and participating in the protein kinase C signaling pathway. This protein is the main postsynaptic protein regulating the availability of calmodulin, binding to it in the absence of calcium. Phosphorylation by protein kinase C lowers its binding ability. Recombinant human NRGN protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography
List Price: $310
  • Buy 5 for $294.5 each and save 5%
  • Buy 21 for $279 each and save 10%
  • Buy 31 for $263.5 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03198
Size 50 µg
Host E.coli
Accession
Molecular Weight 10.0 kDa(101aa) confirmed by MALDI-TOF (Molecular size on SDS-PAGE will appear higher)
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSMDCCTENACSKPDDDILDIPLDDPGANAAAAKIQASFRGHMARKKIKSGERGRKGPGPGGPGGAGVARGGAGGGPSGD
Purity > 95% by HPLC
Concentration 0.5 mg/ml (determined by BCA assay)
Formulation Liquid. 20mM Tris-HCl buffer (pH7.0) containing 30% glycerol 0.1mM PMSF,1mM EDTA
Other Names Neurogranin, hng, RC3
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap