NREP, 1-68aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
NREP, as known as neuronal regeneration-related protein, has roles in neural function. It promotes axonal regeneration. It may also have functions in cellular differentiation. This protein induces differentiation of fibroblast into myofibroblast and increases retinoic-acid regulation of lipid-droplet biogenesis. Recombinant human NREP protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography.
List Price: $310
  • Buy 5 for $294.5 each and save 5%
  • Buy 21 for $279 each and save 10%
  • Buy 31 for $263.5 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03195
Size 20 µg
Host E.coli
Accession
Molecular Weight 10.3kDa (91aa) confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSMVYYPELFVWVSQEPFPNKDMEGRLPKGRLPVPKEVNRKKNDETNAASLTPLGSSELRSPRISYLHFF
Purity > 95% by HPLC
Concentration 0.5 mg/ml (determined by Bradford assay)
Formulation Liquid. 20mM Tris-HCl buffer (pH8.0) containing 10% glycerol, 0.1M NaCl
Other Names Neuronal regeneration-related protein isoform a, C5orf13, D4S114, P311, PRO1873, PTZ17, SEZ17
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap