NRAS, 1-186aa, Human, E.coli

Categories: [Proteins / Peptides]
Neuroblastoma RAS viral (v-ras) oncogene homolog, also known as NRAS, is a member of the RAS gene family. NRAS is an oncogene encoding a membrane protein that shuttles between the Golgi apparatus and the plasma membrane. The encoded protein, which has intrinsic GTPase activity, is activated to a GTP-bound form by a GTPase activating protein and inactivated to a GDP-bound form by a guanine nucleotide-exchange factor.
List Price: $414
  • Buy 5 for $393.3 each and save 5%
  • Buy 21 for $372.6 each and save 10%
  • Buy 31 for $351.9 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03193
Size 50 µg
Host E.coli
Accession
Molecular Weight 20.8 kDa (186aa)
AP_Mol_Weight
Tag
Sequences MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDLPTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQGCMGLPC
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer (pH7.5) containing 100mM NaCl,10% glycerol
Other Names Neuroblastoma RAS viral (v-ras) oncogene homolog, GTPase NRas, HRAS1, ALPS4, N-ras, NRAS1, NS6
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap