Home / Products / proteins / NPM2, 1-214aa, Human, His tag, E.coli

NPM2, 1-214aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
NPM2, also known as nucleophosmin/nucleoplasmin 2, belongs to the nucleoplasmin family. This protein is core histones chaperone involved in chromatin reprogramming, especially during fertilization and early embryonic development. It probably involved in sperm DNA decondensation during fertilization.
List Price: $310
  • Buy 5 for $294.5 each and save 5%
  • Buy 21 for $279 each and save 10%
  • Buy 31 for $263.5 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03189
Size 50 µg
Host E.coli
Accession
Molecular Weight 26.6 kDa (237aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSMNLSSASSTEEKAVTTVLWGCELSQERRTWTFRPQLEGKQSCRLLLHTICLGEKAKEEMHRVEILPPANQEDKKMQPVTIASLQASVLPMVSMVGVQLSPPVTFQLRAGSGPVFLSGQERYEASDLTWEEEEEEEGEEEEEEEEDDEDEDADISLEEQSPVKQVKRLVPQKQASVAKKKKLEKEEEEIRASVRDKSPVKKAKATARAKKPGFKK
Purity > 95% by HPLC
Concentration 0.5 mg/ml
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 0.2M NaCl, 20% glycerol, 2mM DTT
Other Names nucleophosmin/ nucleoplasmin 2, NPM-2.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap