Home / Products / proteins / NOL3, 1-208aa, Human, His tag, E.coli

NOL3, 1-208aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
Nucleolar protein 3 (apoptosis repressor with CARD domain), also known as NOL3, is predominantly expressed in muscle and is present in the nucleoplasm and concentrated in nucleoli. NOL3 mRNA and protein levels are induced by neuronal activity, which is necessary to stimulate neuroplasticity, indicating a potential role for NOL3 in activity-dependent changes in dendrite function.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03185
Size 100 µg
Host E.coli
Accession
Molecular Weight 25 kDa (231aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSMGNAQERPSETIDRERKRLVETLQADSGLLLDALLARGVLTGPEYEALDALPDAERRVRRLLLLVQGKGEAACQELLRCAQRTAGAPDPAWDWQHVGPGYRDRSYDPPCPGHWTPEAPGSGTTCPGLPRASDPDEAGGPEGSEAVQSGTPEEPEPELEAEASKEAEPEPEPEPELEPEAEAEPEPELEPEPDPEPEPDFEERDESEDS
Purity > 95% by HPLC
Concentration 1 mg/ml
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 0.1M NaCl, 10% glycerol,1mM DTT, 1mM EDTA
Other Names Nucleolar protein 3, ARC, MYP, NOP, NOP30.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap