NME3, 22-169aa, Human, His tag, E.coli (Bioactivity Validated)

Categories: [Proteins / Peptides]
NME3, also known as, a potential suppressor of metastasis, is expressed at a much lower level in highly metastatic cells than in cells with lower metastatic potential. It is important for the synthesis of nucleoside triphosphates and may play a role in apoptosis induction and hematopoiesis. It is preferentially expressed during early stages of myeloid differentiation of highly purified CD34+ cells. Recombinant human NME3 protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography.
List Price: $135
  • Buy 5 for $128.25 each and save 5%
  • Buy 21 for $121.5 each and save 10%
  • Buy 31 for $114.75 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03171
Size 20 µg
Host E.coli
Accession
Molecular Weight 19.1 kDa (169aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMERTFLAVKPDGVQRRLVGEIVRRFERKGFKLVALKLVQASEELLREHYAELRERPFYGRLVKYMASGPVVAMVWQGLDVVRTSRALIGATNPADAPPGTIRGDFCIEVGKNLIHGSDSVESARREIALWFRADELLCWEDSAGHWLYE
Purity > 95% by HPLC
Concentration 0.5 mg/ml (determined by Bradford assay)
Formulation Liquid. 20mM Tris-HCl buffer (pH8.0) containing 50% glycerol, 0.1M NaCl, 2mM DTT
Other Names Nucleoside diphosphate kinase 3, c371H6.2, DR-nm23, KIAA0516, NDPK-C, NDPKC, NM23-H3, NM23H3.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap