Home / Products / proteins / Nme2, 1-152aa, Rat, His tag, E.coli

Nme2, 1-152aa, Rat, His tag, E.coli

Categories: [Proteins / Peptides]
Nme2 also known as nucleoside diphosphate kinaseB is a heterodimeric protein functioning as a nucleoside diphosphate (NDP) kinase. Nme2 is a ubiquitous enzyme that catalyses phosphorylation of nucleoside 5'-diphosphate (NDP) to the corresponding triphosphate (NTP), following a Ping-Pong mechanism which includes the formation of a phosphohistidine intermediate. Recombinant rat Nme2, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $397
  • Buy 5 for $377.15 each and save 5%
  • Buy 21 for $357.3 each and save 10%
  • Buy 31 for $337.45 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03169
Size 100 µg
Host E.coli
Accession
Molecular Weight 19.7kDa (175aa) confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSMANLERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYIDLKDRPFFPGLVKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVESAEKEIGLWFKPEELIDYKSCAHDWVYE
Purity > 95% by HPLC
Concentration 1mg/ml (determined by Absorbance at 280nm)
Formulation Liquid. In Phosphate Buffered Saline pH 7.4 contaning 10% glycerol
Other Names NDKB, nm23-2, p18-12d
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap