Home / Products / proteins / NME2, 1-152aa, Human, E.coli

NME2, 1-152aa, Human, E.coli

Categories: [Proteins / Peptides]
NME2, also known as NM23B, is a heterodimeric protein functioning as a nucleoside diphosphate (NDP) kinase. NME1 and NME2 comprise the 152 amino acid A and B polypeptide chains of the NM23 enzyme, respectively. NME2 is identical to the beta subunit of human erythrocyte NDP kinase.
List Price: $397
  • Buy 5 for $377.15 each and save 5%
  • Buy 21 for $357.3 each and save 10%
  • Buy 31 for $337.45 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03167
Size 100 µg
Host E.coli
Accession
Molecular Weight 17.2 kDa (152aa)
AP_Mol_Weight
Tag
Sequences MANLERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYIDLKDRPFFPGLVKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVKSAEKEISLWFKPEELVDYKSCAHDWVYE
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20 mM Tris-HCl buffer (pH8.0) containing 1mM DTT,10% glycerol
Other Names Nucleoside diphosphate kinase B, NDPK-B, NDPKB, NM23-H2, NM23B
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap