NME2, 1-152aa, Human, E.coli (Bioactivity Validated)

Categories: [Proteins / Peptides]
NME2, also known as NM23B, is a heterodimeric protein functioning as a nucleoside diphosphate (NDP) kinase. NME1 and NME2 comprise the 152 amino acid A and B polypeptide chains of the NM23 enzyme, respectively. NME2 is identical to the beta subunit of human erythrocyte NDP kinase. NDP kinases are involved in the synthesis of nucleoside triphosphates, and NM23 may act in the regulation of signal transduction by complexing with G proteins, causing activation/inactivation of developmental pathways. Recombinant human NME2 protein was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $494
  • Buy 5 for $469.3 each and save 5%
  • Buy 21 for $444.6 each and save 10%
  • Buy 31 for $419.9 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03168
Size 20 µg
Host E.coli
Accession
Molecular Weight 17.2 kDa (152aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag
Sequences MANLERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYIDLKDRPFFPGLVKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVKSAEKEISLWFKPEELVDYKSCAHDWVYE
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20 mM Tris-HCl buffer (pH8.0) containing 1mM DTT, 10% glycerol
Other Names Nucleoside diphosphate kinase B, NDPK-B, NDPKB, NM23-H2, NM23B.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap