NME1, 1-152aa, Human, E.coli (Bioactivity Validated)

Categories: [Proteins / Peptides]
Non-metastatic cells 1 (NME1), also known as NM23-H1, originally identified as a candidate metastasis suppressor gene. NME1 is expressed in different tumor types where their levels have been alternatively associated with reduced or increased metastatic potential. Reductions in NME1 expression have been significantly associated with aggressive behavior in melanoma, breast, colon, and gastric carcinomas. On the contrary, high levels of NME1 gene expression are noted in the advanced stage of thyroid carcinomas. Recombinant human NME1 was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $397
  • Buy 5 for $377.15 each and save 5%
  • Buy 21 for $357.3 each and save 10%
  • Buy 31 for $337.45 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03166
Size 20 µg
Host E.coli
Accession
Molecular Weight 17.1 kDa (152aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag
Sequences MANCERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFMQASEDLLKEHYVDLKDRPFFAGLVKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVESAEKEIGLWFHPEELVDYTSCAQNWIYE
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer (pH7.5) containing 1mM DTT, 10% glycerol
Other Names Non-metastatic cells 1, Nucleoside diphosphate kinase A, NDP kinase A, AWD, GAAD, NB, NBS, NDPK-A, NM23, NM23-H1.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap