Home / Products / proteins / NME1, 1-152 aa, Human, Recombinant, E.coli

NME1, 1-152 aa, Human, Recombinant, E.coli

Categories: [Proteins / Peptides]
Non-metastatic cells 1 (NME1), also known as NM23-H1, originally identified as a candidate metastasis suppressor gene. NME1 is expressed in different tumor types where their levels have been alternatively associated with reduced or increased metastatic potential. Reductions in NME1 expression have been significantly associated with aggressive behavior in melanoma, breast, colon, and gastric carcinomas.
List Price: $397
  • Buy 5 for $377.15 each and save 5%
  • Buy 21 for $357.3 each and save 10%
  • Buy 31 for $337.45 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03165
Size 100 µg
Host E.coli
Accession
Molecular Weight 17.1 kDa (152aa)
AP_Mol_Weight
Tag
Sequences MANCERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFMQASEDLLKEHYVDLKDRPFFAGLVKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVESAEKEIGLWFHPEELVDYTSCAQNWIYE
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer (pH7.5) containing 1mM DTT, 10% glycerol
Other Names Non-metastatic cells 1, Nucleoside diphosphate kinase A, NDP kinase A, AWD, GAAD, NB, NBS, NDPK-A, NM23, NM23-H1
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap