Home / Products / proteins / NMB, 25-121aa, Human, His tag, E.coli

NMB, 25-121aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
Neuromedin B, also known as NMB, belongs to the bombesin/neuromedin-B/ranatensin family and stimulates smooth muscle contraction in a manner similar to that of bombesin. Recombinant human NMB protein, fused to His-tag at N-terminus, was expressed in E.coli.
List Price: $310
  • Buy 5 for $294.5 each and save 5%
  • Buy 21 for $279 each and save 10%
  • Buy 31 for $263.5 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03164
Size 50 µg
Host E.coli
Accession
Molecular Weight 13.2kDa (120aa)
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSAPLSWDLPEPRSRASKIRVHSRGNLWATGHFMGKKSLEPSSPSPLGTAPHTSLRDQRLQLSHDLLGILLLKKALGVSLSRPAPQIQYRRLLVQILQK
Purity > 95% by HPLC
Concentration 0.5 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 0.4M urea, 10% glycerol
Other Names Neuromedin B, MGC17211, MGC2277, MGC3936, Neuromedin-B
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap