Home / Products / proteins / NIP7, 1-180aa, Human, His tag, E.coli

NIP7, 1-180aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
NIP7, also known as the 60S ribosome subunit biogenesis protein NIP7 homolog, belongs to NIP7 family and contains 1 PUA domain. It interacts with pre-ribosome complex and may bind to RNA. This protein is required for proper 27S pre-rRNA processing and 60S ribosome subunit assembly. Recombinant human NIP7 protein, fused to His-tag at C-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $316
  • Buy 5 for $300.2 each and save 5%
  • Buy 21 for $284.4 each and save 10%
  • Buy 31 for $268.6 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03158
Size 100 µg
Host E.coli
Accession
Molecular Weight 21.5 kDa (188aa)
AP_Mol_Weight
Tag N-6His
Sequences MRPLTEEETRVMFEKIAKYIGENLQLLVDRPDGTYCFRLHNDRVYYVSEKIMKLAANISGDKLVSLGTCFGKFTKTHKFRLHVTALDYLAPYAKYKVWIKPGAEQSFLYGNHVLKSGLGRITENTSQYQGVVVYSMADIPLGFGVAAKSTQDCRKVDPMAIVVFHQADIGEYVRHEETLTLEHHHHHH
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. 20mM Tris-HCl buffer (pH8.0) containing 20% glycerol 0.1M NaCl
Other Names 60S ribosome subunit biogenesis protein NIP7 homolog, CGI-37, HSPC031, KD93
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap