Home / Products / proteins / NHP2L1, 1-128aa, Human, His tag, E.coli

NHP2L1, 1-128aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
NHP2L1 belongings to the ribosomal protein L7Ae family. This protein localizes to the nucleus, mainly concentrated in the dense fibrillar component of the nucleolus. It directly binds to the 5' stem-loop of U4 snRNA and plays an important role in the late stage of spliceosome assembly, prior to step I of splicing catalysis. Recombinant human NHP2L1 protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography.
List Price: $414
  • Buy 5 for $393.3 each and save 5%
  • Buy 21 for $372.6 each and save 10%
  • Buy 31 for $351.9 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03157
Size 50 µg
Host E.coli
Accession
Molecular Weight 16.7 kDa(152aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSHMTEADVNPKAYPLADAHLTKKLLDLVQQSCNYKQLRKGANEATKTLNRGISEFIVMAADAEPLEIILHLPLLCEDKNVPYVFVRSKQALGRACGVSRPVIACSVTIKEGSQLKQQIQSIQQSIERLLV
Purity > 95% by HPLC
Concentration 0.25 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20 mM Tris-HCl Buffer (pH 7.5) containing 100 mM NaCl, 10% Glycerol
Other Names NHP2(non-histone chromosome protein 2)-like 1, FA1, NHPX, OTK27, SNRNP15-5, SNU13, SPAG12, SSFA1
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap