Home / Products / proteins / NHP2, 1-153aa, Human, His tag, E.coli

NHP2, 1-153aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
NHP2, also called NOLA2, forms a small ribonucleoprotein particle with GAR1(NOLA1), Nop10 for the isomerization of uridine to pseudouridine. This protein is involved in various aspects of rRNA processing and modification. It localizes to the dense fibrillar component of the nucleolus and in nuclear Cajal bodies. Recombinant human NHP2 protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography.
List Price: $487
  • Buy 5 for $462.65 each and save 5%
  • Buy 21 for $438.3 each and save 10%
  • Buy 31 for $413.95 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03156
Size 100 μg
Host E.coli
Accession
Molecular Weight 19.3 kDa (173aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMTKIKADPDGPEAQAEACSGERTYQELLVNQNPIAQPLASRRLTRKLYKCIKKAVKQKQIRRGVKEVQKFVNKGEKGIMVLAGDTLPIEVYCHLPVMCEDRNLPYVYIPSKTDLGAAAGSKRPTCVIMVKPHEEYQEAYDECLEEVQSLPLPL
Purity > 95% by HPLC
Concentration 0.25 mg/ml (determined by Bradford assay)
Formulation Liquid. 20mM Tris-HCl buffer (pH8.0) containing 20% glycerol 0.1M NaCl, 1mM DTT
Other Names H/ACA ribonucleoprotein complex subunit 2 isoform a, NHP2P, NOLA2
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap