NFKBID, 1-313aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
NF-kappa-B inhibitor delta, also known as NFKBID, is a member of the IkB family of proteins can be divided into four groups (IkB-alpha, IkB-beta, IkB-gamma, IkB-epsilon). NFKBID plays a role in the regulation of both inflammatory responses and cytokine, IL-2 and IL-6 expression via NFkB activity. Existing as three alternatively spliced isoforms, NFKBID associates with RelB, NFkB p50 and NFkB p65 in nucleus, and is thought to assist in thymocyte selection in response to TCR induction. Recombinant human NFKBID protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03150
Size 100 µg
Host E.coli
Accession
Molecular Weight 35.9 kDa (336aa) confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSMEAGPWRVSAPPSGPPQFPAVVPGPSLEVARAHMLALGPQQLLAQDEEGDTLLHLFAARGLRWAAYAAAEVLQVYRRLDIREHKGKTPLLVAAAANQPLIVEDLLNLGAEPNAADHQGRSVLHVAATYGLPGVLLAVLNSGVQVDLEARDFEGLTPLHTAILALNVAMRPSDLCPRVLSTQARDRLDCVHMLLQMGANHTSQEIKSNKTVLHLAVQAANPTLVQLLLELPRGDLRTFVNMKAHGNTALHMAAALPPGPAQEAIVRHLLAAGADPTLRNLENEQPVHLLRPGPGPEGLRQLLKRSRVAPPGLSS
Purity > 95% by HPLC
Concentration 0.5mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 0.15M NaCl, 10% glycerol, 1mM DTT
Other Names NF-kappa-B inhibitor delta, IkappaBNS, TA-NFKBH
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap