Neurokinin B, 17-121 aa, Human, His-tagged, Recombinant, E.coli

Categories: [Proteins / Peptides]
Neurokinin B, a member of the substance P-related tachykinin family, was previously known to be present in the same hypothalamic neurons as kisspeptin. This protein and its receptor are critical switches of regulator of human puberty, governed by the brain through the release of the hormone GnRH (gonadotropinreleasing hormone) which starts a series of processes that ultimately leads to the production of sex hormones.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03146
Size 100 µg
Host E.coli
Accession
Molecular Weight 13.8 kDa (125aa)
AP_Mol_Weight
Tag
Sequences MGSSHHHHHHSSGLVPRGSHQSFGAVCKEPQEEVVPGGGRSKRDPDLYQLLQRLFKSHSSLEGLLKALSQASTDPKESTSPEKRDMHDFFVGLMGKRSVQPDSPTDVNQENVPSFGILKYPPRAE
Purity > 95% by HPLC
Concentration 0.5 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20 mM Tris-HCl buffer (pH 8.0) containing 20% glycerol
Other Names ZNEUROK1, Neuromedin K, Tachykinin3. TAC3, NKB, NKNB
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap