Home / Products / proteins / NECAP2, 1-263aa, Human, His tag, E.coli

NECAP2, 1-263aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
NECAP2, also known as adaptin ear-binding coat-associated protein 2, is a essential protein paralogues for clathrin-mediated membrane trafficking that are enriched in CCV coats. This protein colocalizes with AP-2 at the plasma membrane by binding AP-2s α-ear domain, and interacts with AP-1, AP-2 and several GAE domain proteins termed GGA1, GGA2 and GGA3. NECAP2 is Involved in endocytosis.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03136
Size 100 µg
Host E.coli
Accession
Molecular Weight 30.5 kDa (283 aa) confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMEESGYESVLCVKPDVHVYRIPPRATNRGYRAAEWQLDQPSWSGRLRITAKGQMAYIKLEDRTSGELFAQAPVDQFPGTAVESVTDSSRYFVIRIEDGNGRRAFIGIGFGDRGDAFDFNVALQDHFKWVKQQCEFAKQAQNPDQGPKLDLGFKEGQTIKLNIANMKKKEGAAGNPRVRPASTGGLSLLPPPPGGKTSTLIPPPGEQLAVGGSLVQPAVAPSSGGAPVPWPQPNPATADIWGDFTKSTGSTSSQTQPGTGWVQF
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer(pH 8.0) containing 10% glycerol, 2mM DTT, 0.1M NaCl.
Other Names NECAP endocytosis associated 2, FLJ10420.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap