NDUFA5, 1-116aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5, also known as NDUFA5, belongs to the complex I NDUFA5 subunit family. The human NDUFA5 gene codes for the B13 subunit of complex I of the respiratory chain, which transfers electrons from NADH to ubiquinone. The high degree of conservation of NDUFA5 extending to plants and fungi indicates its functional significance in the enzyme complex. The protein localizes to the inner mitochondrial membrane as part of the 7 component-containing, water soluble 'iron-sulfur protein' (IP) fraction of complex I, although its specific role is unknown.
List Price: $310
  • Buy 5 for $294.5 each and save 5%
  • Buy 21 for $279 each and save 10%
  • Buy 31 for $263.5 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03124
Size 20 µg
Host E.coli
Accession
Molecular Weight 15.8 kDa (139aa) confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSMAGVLKKTTGLVGLAVCNTPHERLRILYTKILDVLEEIPKNAAYRKYTEQITNEKLAMVKAEPDVKKLEDQLQGGQLEEVILQAEHELNLARKMREWKLWEPLVEEPPADQWKWPI
Purity > 95% by HPLC
Concentration 1 mg/ml
Formulation 15M NaCl, 10% glycerol, 1mM DTT
Other Names NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5, B13, CI-13kB, CI-13KD-B, NUFM, UQOR13.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap