Home / Products / proteins / NDRG2, 1-357aa, Human, His tag, E.coli

NDRG2, 1-357aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
NDRG2, also known as SYLD, is a member of the N-myc downregulated gene family which belongs to the alpha/beta hydrolase superfamily. Expressed at high levels in heart, brain, dendritic cells, salivary gland and skeletal muscle and at lower levels in liver and kidney, NDRG2 is thought to be involved in dendritic and neuronal cell differentiation and outgrowth. It is found in brain lesions of Alzheimer Disease (AD)-affected patients and is thought to be associated with the progression of AD.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03120
Size 100 µg
Host E.coli
Accession
Molecular Weight 41.8 kDa (381aa)
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSHMAELQEVQITEEKPLLPGQTPEAAKTHSVETPYGSVTFTVYGTPKPKRPAILTYHDVGLNYKSCFQPLFQFEDMQEIIQNFVRVHVDAPGMEEGAPVFPLGYQYPSLDQLADMIPCVLQYLNFSTIIGVGVGAGAYILARYALNHPDTVEGLVLINIDPNAKGWMDWAAHKLTGLTSSIPEMILGHLFSQEELSGNSELIQKYRNIITHAPNLDNIELYWNSYNNRRDLNFERGGDITLRCPVMLVVGDQAPHEDAVVECNSKLDPTQTSFLKMADSGGQPQLTQPGKLTEAFKYFLQGMGYMASSCMTRLSRSRTASLTSAASVDGNRSRSRTLSQSSESGTLSSGPPGHTMEVSC
Purity > 95% by HPLC
Concentration 1 mg/ml
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 0.4M Urea,10% glycerol, 0.1M NaCl
Other Names protein NDRG2, SYLD.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap