Home / Products / proteins / NCR2, 19-130aa, Human, His tag, E.coli

NCR2, 19-130aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
NCR2 belongs to the natural cytotoxicity receptor (NCR) family and contains 1 Ig-like (immunoglobulin-like) domain. This protein interacts with TYROBP/DAP12 and is selectively expressed by activated NK cells and by in vitro cultured (i.e. activated) TCRg/d lymphoid cells. NCR2 is a cytotoxicity-activating receptor that may contribute to the increased efficiency of activated natural killer (NK) cells to mediate tumor cell lysis. Recombinant human NKP44 protein, fused to His-tag at N-terminus, was expressed in E.coli
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03111
Size 100 µg
Host E.coli
Accession
Molecular Weight 15.0 kDa (133aa)
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMSQAQSKAQVLQSVAGQTLTVRCQYPPTGSLYEKKGWCKEASALVCIRLVTSSKPRTMAWTSRFTIWDDPDAGFFTVTMTDLREEDSGHYWCRIYRPSDNSVSKSVRFYLVVS
Purity > 95% by HPLC
Concentration 1.0 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 10% glycerol, 0.4M Urea
Other Names Natural cytotoxicity triggering receptor 2 isoform 1, CD336, LY95, NK-p44 NKP44
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap