NCR, NKp46 ( Extracellular Ig-like domain ; 22-255aa, human), Recombinant, E.coli

Categories: [Proteins / Peptides]
A natural cytotoxicity receptor(NCR) NKp46 has been shown to represent a novel NK cell-specific molecule involved in human NK cell activation. The natural cytotoxicity receptors(NCRs) are a recently characterized family of Iglike activation receptors that appear to be major triggering receptors in tumor cell recognition. The three known NCRs include NKp46 and NKp30,which are expressed on circulating NKcells, and NKp44,which is expressed only on activating NK cells. NKp46 has been implicated in NK cell-mediated lysis of several autologous tumor cells and pathogen-infected cell lines. NKp46 has two extracellular Ig-like domains followed by a ~40 residue stalk region, a type I transmembrane domain, and a short cytoplasmic tail. The extracellular Ig-like domain of NKp46( 22-255aa) was overexpressed in E.coli, and purified by FPLC gel-filtration chromatography, after refolding of the isolated inclusion bodies in a redox buffer.
List Price: $473
  • Buy 5 for $449.35 each and save 5%
  • Buy 21 for $425.7 each and save 10%
  • Buy 31 for $402.05 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03109
Size 100 µg
Host E.coli
Accession
Molecular Weight 26.6 kDa (235 aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag
Sequences MQQQTLPKPFIWAEPHFMVPKEKQVTICCQGNYGAVEYQLHFEGSLFAVDRPKPPERINKVKFYIPDMNSRMAGQYSCIYRVGELWSEPSNLLDLVVTEMYDTPTLSVHPGPEVISGEEVTFYCRLDTATSMFLLLKEGRSSHVQRGYGKVQAEFPLGPVTTAHRGTYRXFGSYNNHAWSFPSEPVKLLVTGDIENTSLAPEDPTFSADTWGTYLLTTETGLQKDHALWDHTAQN
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In phosphate buffered saline (pH 7.4) containing 1 mM EDTA
Other Names Natural cytotoxicity triggering receptor 1 isoform a, CD335, LY94, NK-p46
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap