Data Sheet | Click for Datasheet |
---|---|
Catalog Number | TP03109 |
Size | 100 µg |
Host | E.coli |
Accession | |
Molecular Weight | 26.6 kDa (235 aa), confirmed by MALDI-TOF |
AP_Mol_Weight | |
Tag | |
Sequences | MQQQTLPKPFIWAEPHFMVPKEKQVTICCQGNYGAVEYQLHFEGSLFAVDRPKPPERINKVKFYIPDMNSRMAGQYSCIYRVGELWSEPSNLLDLVVTEMYDTPTLSVHPGPEVISGEEVTFYCRLDTATSMFLLLKEGRSSHVQRGYGKVQAEFPLGPVTTAHRGTYRXFGSYNNHAWSFPSEPVKLLVTGDIENTSLAPEDPTFSADTWGTYLLTTETGLQKDHALWDHTAQN |
Purity | > 95% by HPLC |
Concentration | 1 mg/ml (determined by Bradford assay) |
Formulation | Liquid. In phosphate buffered saline (pH 7.4) containing 1 mM EDTA |
Other Names | Natural cytotoxicity triggering receptor 1 isoform a, CD335, LY94, NK-p46 |
Bioactivity | |
Storage | Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles. |
Postscript | For research use only, not for use in diagnostic procedures. |
© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap