NBL1, 18-181aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
Neuroblastoma suppressor of tumorigenicity 1, also known as NBL1, is a member of the evolutionarily conserved CAN (Cerberus and DAN) family of proteins, which contain a domain resembling the CTCK (C-terminal cystine knot-like) motif found in a number of signaling molecules. NBL1 is a candidate as a tumor suppressor of neuroblastoma and may play a role in preventing cells from entering the final stage (G1/S) of the transformation process. It is produced in small neurons of the dorsal root ganglion and its expression is activated by MATH-1. Recombinant human NBL1 protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03101
Size 100 µg
Host E.coli
Accession
Molecular Weight 20 kDa (187aa) confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSAPPPINKLALFPDKSAWCEAKNITQIVGHSGCEAKSIQNRACLGQCFSYSVPNTFPQSTESLVHCDSCMPAQSMWEIVTLECPGHEEVPRVDKLVEKILHCSCQACGKEPSHEGLSVYVQGEDGPGSQPGTHPHPHPHPHPGGQTPEPEDPPGAPHTEEEGAED
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 0.1M NaCl, 10% glycerol, 1mM DTT
Other Names Neuroblastoma suppressor of tumorigenicity 1, D1S1733E, DAN, DAND1, NB, NO3
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap