Home / Products / proteins / NANOGP8, 1-305aa, Human, His tag, E.coli

NANOGP8, 1-305aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
Homeobox protein NANOGP8, also known as NANOGP8, is a member of the homeobox family of DNA binding transcription factors that has been shown to maintain pluripotency of embryonic stem cells. Almost identical to NANOG, there is only one change in the inferred amino acid sequence from 'Gln-253' in NANOG to His-253 in NANOGP8. Recombinant human NANOGP8 protein was expressed in E.coli.
List Price: $310
  • Buy 5 for $294.5 each and save 5%
  • Buy 21 for $279 each and save 10%
  • Buy 31 for $263.5 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03089
Size 20 µg
Host E.coli
Accession
Molecular Weight 34.6kDa (305aa)
AP_Mol_Weight
Tag N-6His
Sequences MSVDPACPQSLPCFEASDCKESSPMPVICGPEENYPSLQMSSAEMPHTETVSPLPSSMDLLIQDSPDSSTSPKGKQPTSAENSVAKKEDKVPVKKQKTRTVFSSTQLCVLNDRFQRQKYLSLQQMQELSNILNLSYKQVKTWFQNQRMKSKRWQKNNWPKNSNGVTQKASAPTYPSLYSSYHQGCLVNPTGNLPMWSNQTWNNSTWSNQTQNIQSWSNHSWNTQTWCTQSWNNQAWNSPFYNCGEESLQSCMHFQPNSPASDLEAALEAAGEGLNVIQQTTRYFSTPQTMDLFLNYSMNMQPEDV
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 0.4M Urea, 5% glycerol
Other Names Homeobox protein NANOGP8, NANOG, NANOGP1, PN8, Nanog homeobox pseudogene 8
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap