Home / Products / proteins / NACA, 1-215 aa , Human, His tag E.coli

NACA, 1-215 aa , Human, His tag E.coli

Categories: [Proteins / Peptides]
NACA is member of the nascent polypeptide associated complex (NAC) alpha subunit family that participate in preventing inappropriate targeting of non-secretory polypeptides to the endoplasmic reticulum (ER). Most NACA proteins localize to both nucleus as well as cytoplasm, and contain NAC-A/B (NAC-alpha/beta) and UBA (ubiquitin-associated) domains. The UBA domain is associated with proteins involved in the ubiquitinproteasome pathway for protein degradation.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03081
Size 100 µg
Host E.coli
Accession
Molecular Weight 25.5 kDa (235aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMPGEATETVPATEQELPQPQAETGSGTESDSDESVPELEEQDSTQATTQQAQLAAAAEIDEEPVSKAKQSRSEKKARKAMSKLGLRQVTGVTRVTIRKSKNILFVITKPDVYKSPASDTYIVFGEAKIEDLSQQAQLAAAEKFKVQGEAVSNIQENTQTPTVQEESEEEEVDETGVEVKDIELVMSQANVSRAKAVRALKNNSNDIVNAIMELTM
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by BCA)
Formulation Liquid. In 20mM Tris-HCl buffer(pH 8.0) containing 10% glycerol, 1mM DTT, 0.15M NaCl.
Other Names Nascent polypeptide-associated complex alpha subunit, HSD48, MGC117224, NACA1.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap