Home / Products / proteins / NAA10, 1-235aa, Human, His tag, E.coli

NAA10, 1-235aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
NAA10 belongs to the acetyltransferase family. NAA10 interacts NAA15, HIF-1 with the ribosome. In its binding to HIF-1, NAA10 acts as a protein acetyltransferase by regulating its stability. In many cell lines, NAA10 is downregulated in response to hypoxia. NAA10 is expressed throughout the development of the brain. Recombinant human NAA10 protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $487
  • Buy 5 for $462.65 each and save 5%
  • Buy 21 for $438.3 each and save 10%
  • Buy 31 for $413.95 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03077
Size 100ug
Host E.coli
Accession
Molecular Weight 28.6kDa (255aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMNIRNARPEDLMNMQHCNLLCLPENYQMKYYFYHGLSWPQLSYIAEDENGKIVGYVLAKMEEDPDDVPHGHITSLAVKRSHRRLGLAQKLMDQASRAMIENFNAKYVSLHVRKSNRAALHLYSNTLNFQISEVEPKYYADGEDAYAMKRDLTQMADELRRHLELKEKGRHVVLGAIENKVESKGNSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSEASDSAS
Purity > 95% by HPLC
Concentration 1mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 5mM DTT, 10% glycerol, 200mM NaCl
Other Names N (alpha)-acetyltransferase 10, NatA catalytic subunit, ARD1, ARD1A, DXS707, MGC71248, TE2.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap