N-acetyltransferase 6, 1-308 aa, Human, His-tagged, Recombinant, E.coli

Categories: [Proteins / Peptides]
N-acetyltransferase, also known as FUS2 (NAT6), is an enzyme that catalyzes the transfer of acetyl groups from acetyl-CoA to acrylamines. This enzyme is physically localized in the cytoplasm and its activity has been documented by its feasibility to acetylate the N-terminus of proteins using a ping-pong-like mechanism and by its substrate specificity. Since the Fus-2 gene maps to the chromosomal region 3p21.3, which contains at least one tumor suppressor gene, the N-acetyltransferase functions of Fus-2 may be relevant to its potential role in cancer.
List Price: $487
  • Buy 5 for $462.65 each and save 5%
  • Buy 21 for $438.3 each and save 10%
  • Buy 31 for $413.95 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03074
Size 10 µg
Host E.coli
Accession
Molecular Weight 35.9 kDa (328aa), confirmed by MALDI-TOF (Molecular weight on SDS-PAGE will shift up)
AP_Mol_Weight
Tag
Sequences MGSSHHHHHHSSGLVPRGSHMQELTLSPGPAKLTPTLDPTHRMELILSTSPAELTLDPACQPKLPLDSTCQPEMTFNPGPTELTLDPEHQPEETPAPSLAELTLEPVHRRPELLDACADLINDQWPRSRTSRLHSLGQSSDAFPLCLMLLSPHPTLEAAPVVVGHARLSRVLNQPQSLLVETVVVARALRGRGFGRRLMEGLEVFARARGFRKLHLTTHDQVHFYTHLGYQLGEPVQGLVFTSRRLPATLLNAFPTAPSPRPPRKAPNLTAQAAPRGPKGPPLPPPPPLPECLTISPPVPSGPPSKSLLETQYQNVRGRPIFWMEKDI
Purity > 95% by HPLC
Concentration 0.5 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20 mM Tris-HCl buffer (pH 8.0) containing 100 mM NaCl 20% glycerol.
Other Names Protein fusion-2, FUS2, FUS-2, NAT6
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap