Home / Products / proteins / MYL6B, 1-208aa, Human, His tag, E.coli

MYL6B, 1-208aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
MYL6B is a heavy chain regulator found in smooth muscle and non-muscle Myosin complexes. Contractile activity in smooth muscle is regulated by the calcium/calmodulin-dependent phosphorylation of Myosin light chain by Myosin light chain kinase. MYL6B does not bind calcium during contraction. It is primarily found in a hexamer consisting of four light chains and two heavy chains.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03067
Size 100 µg
Host E.coli
Accession
Molecular Weight 25.2 kDa (231aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSMPPKKDVPVKKPAGPSISKPAAKPAAAGAPPAKTKAEPAVPQAPQKTQEPPVDLSKVVIEFNKDQLEEFKEAFELFDRVGDGKILYSQCGDVMRALGQNPTNAEVLKVLGNPKSDELKSRRVDFETFLPMLQAVAKNRGQGTYEDYLEGFRVFDKEGNGKVMGAELRHVLTTLGEKMTEEEVETVLAGHEDSNGCINYEAFLKHILSV
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay )
Formulation Liquid. In 20mM Tris-HCl buffer(pH 8.0) containing 10% glycerol, 2mM DTT.
Other Names Myosin light chain 6B, MLC1SA.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap