Home / Products / proteins / MYCBP, 1-103aa, Human, His tag, E.coli

MYCBP, 1-103aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
MYCBP, also known as c-Myc binding protein, binds to the transactivation domain of c-Myc and stimulates the activation of E-box-dependent transcription. It translocates from the cytoplasm to the nucleus during S phase when increased expression of c-Myc occurs. It has also been shown to associate with AKAP 149 and AKAP 84 in mitochondria of somatic cells and sperm, which suggests a role for MYCBP in spermatogenesis.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03058
Size 100 µg
Host E.coli
Accession
Molecular Weight 14.1 kDa (123aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMAHYKAADSKREQFRRYLEKSGVLDTLTKVLVALYEEPEKPNSALDFLKHHLGAATPENPEIELLRLELAEMKEKYEAIVEENKKLKAKLAQYEPPQEEKRAE
Purity > 95% by HPLC
Concentration 1.0 mg/ml (determined by Bradford assay)
Formulation Liquid. 20mM Tris-HCl buffer (pH8.0) containing 20% glycerol 0.1M NaCl,1mM DTT
Other Names C-Myc-binding protein, AMY-1, FLJ41056.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap