Home / Products / proteins / MUTED, 1-187aa, Human, His tag, E.coli

MUTED, 1-187aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
Muted homolog, also known as MUTED, is involved in the development of lysosome related organelles, such as melanosomes and platelet dense granules. MUTED interacts with pallidin, dystrobrevin binding protein 1 and CNO/cappuccino. It is part of the biogenesis of lysosome related organelles complex 1 (BLOC1). Also, MUTED is ubiquitously expressed with higher levels in brain, bone marrow, kidney, and liver and lower levels in skeletal muscle.
List Price: $310
  • Buy 5 for $294.5 each and save 5%
  • Buy 21 for $279 each and save 10%
  • Buy 31 for $263.5 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03050
Size 20 µg
Host E.coli
Accession
Molecular Weight 24 kDa (210aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSMSGGGTETPVGCEAAPGGGSKKRDSLGTAGSAHLIIKDLGEIHSRLLDHRPVIQGETRYFVKEFEEKRGLREMRVLENLKNMIHETNEHTLPKCRDTMRDSLSQVLQRLQAANDSVCRLQQREQERKKIHSDHLVASEKQHMLQWDNFMKEQPNKRAEVDEEHRKAMERLKEQYAEMEKDLAKFSTF
Purity > 95% by HPLC
Concentration 0.25 mg/ml
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 0.1M NaCl, 40% glycerol,2mM DTT, 0.1mM PMSF, 1mM EDTA
Other Names Muted homolog, MU.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap