MUP1, 19-180aa, Mouse His tag, E.coli

Categories: [Proteins / Peptides]
MUP1 is a subfamily of proteins found in abundance in the urine and other secretions of many animals. It provides a small range of identifying information about the donor animal, when detected by the vomeronasal organ of the receiving animal. It can also act as protein pheromones themselves. It has been demonstrated to promote aggression in male mice, and one specific Mup protein found in male mouse urine is sexually attractive to female mice. Recombinant mouse MUP1 protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03048
Size 100 µg
Host E.coli
Accession
Molecular Weight 21.1 kDa(185aa) confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSEEASSTGRNFNVEKINGEWHTIILASDKREKIEDNGNFRLFLEQIHVLENSLVLKFHTVRDEECSELSMVADKTEKAGEYSVTYDGFNTFTIPKTDYDNFLMAHLINEKDGETFQLMGLYGREPDLSSDIKERFAQLCEKHGILRENIIDLSNANRCLQARE
Purity > 95% by HPLC
Concentration 1.0 mg/ml (determined by BCA assay)
Formulation Liquid. 20mM Tris-HCl buffer (pH8.0) containing 10% glycerol. 0.1M NaCl
Other Names Major urinary protein 1 isoform b precursor, Ltn-1, Lvtn-1, Mup-1, Mup-a, Mup10, Mup7, Up-1
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap