MUCL1, 21-90aa Human, His tag, E.coli

Categories: [Proteins / Peptides]
MUCL1 may play a role as marker for the diagnosis of metastatic breast cancer. This protein is expressed in mammary, salivary glands and prostate. Recombinant human MUCL1 protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $310
  • Buy 5 for $294.5 each and save 5%
  • Buy 21 for $279 each and save 10%
  • Buy 31 for $263.5 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03046
Size 20 µg
Host E.coli
Accession
Molecular Weight 9.3 kDa (93aa) confirmed by MALDI-TOF (Molecular size on SDS-PAGE will appear higher)
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSNPTTAAPADTYPATGPADDEAPDAETTAAATTATTAAPTTATTAASTTARKDIPVLPKWVGDLPNGRVCP
Purity > 95% by HPLC
Concentration 0.25 mg/ml (determined by BCA assay)
Formulation Liquid. In Phosphate buffer saline (pH 7.4) containing 10% glycerol
Other Names Mucin-like protein 1, SBEM
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap