MTPN, 1-118aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
MTPN (myotrophin), an ankyrin repeat protein, is stimulates protein synthesis and cardiomyocyte growth to initiate cardiac hypertrophy by activating the NF-kappaB signaling cascade. This protein plays a potential role in cerebellar morphogenesis and may function in differentiation of cerebellar neurons, particularly of granule cells. Elevated levels of MTPN are expressed in human dilated cardiomyopathic and ischemic hearts.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03045
Size 100 µg
Host E.coli
Accession
Molecular Weight 15.0 kDa(138aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMCDKEFMWALKNGDLDEVKDYVAKGEDVNRTLEGGRKPLHYAADCGQLEILEFLLLKGADINAPDKHHITPLLSAVYEGHVSCVKLLLSKGADKTVKGPDGLTAFEATDNQAIKALLQ
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20 mM Tris-HCl Buffer (pH 8.0) containing 10% Glycerol
Other Names Myotrophin, Protein V-1, GCDP
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap