Home / Products / proteins / MT3, 1-68aa, Human, His tag, E.coli

MT3, 1-68aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
Metallothionein 3, also known as MT3, binds heavy metals. This protein contains three zinc and three copper atoms per polypeptide chain and only a negligible amount of cadmium. This protein inhibits survival and neurite formation of cortical neurons in vitro. Recombinant human MT3 protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $487
  • Buy 5 for $462.65 each and save 5%
  • Buy 21 for $438.3 each and save 10%
  • Buy 31 for $413.95 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03040
Size 100 µg
Host E.coli
Accession
Molecular Weight 9.3 kDa (91aa) confirmed by MALDI-TOF (Molecular size on SDS-PAGE will appear higher)
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSMDPETCPCPSGGSCTCADSCKCEGCKCTSCKKSCCSCCPAECEKCAKDCVCKGGEAAEAEAEKCSCCQ
Purity > 95% by HPLC
Concentration 0.5 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 0.15M NaCl, 10% glycerol
Other Names Metallothionein 3 , GIF, GIFB, GRIF, ZnMT3
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap