Home / Products / proteins / MSRB2, 21-182aa, Human, His tag, E.coli

MSRB2, 21-182aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
MSRB2 is one of the methionine sulfoxide reductases(MSRs) family, the antioxidant repair enzymes. This protein catalyzes the reduction of free and protein-bound methionine sulfoxide to methionine. It may have a role in protecting against oxidative stress in many organs. Recombinant human MSRB2 protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03037
Size 100 µg
Host E.coli
Accession
Molecular Weight 19.5 kDa(183a) confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMVRGQAGGGGPGTGPGLGEAGSLATCELPLAKSEWQKKLTPEQFYVTREKGTEPPFSGIYLNNKEAGMYHCVCCDSPLFSSEKKYCSGTGWPSFSEAHGTSGSDESHTGILRRLDTSLGSARTEVVCKQCEAHLGHVFPDGPGPNGQRFCINSVALKFKPRKH
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20 mM Tris-HCl Buffer (pH 7.5) containing 1 mM DTT, 0.1 mM PMSF, 10% Glycerol
Other Names Methionine sulfoxide reductase B2, CBS-1, CBS1, CGI-131, MSRB, PILB
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap