Home / Products / proteins / msrB, 1-137aa, E.coli, His tag, E.coli

msrB, 1-137aa, E.coli, His tag, E.coli

Categories: [Proteins / Peptides]
MsrB, also known as, methionine sulfoxide reductase B from Escherichia coli, belongs to the msrB Met sulfoxide reductase family. E.coli msrB carries out the reduction of methionine-R-sulfoxide to methionine. This protein possess a metal binding site composed of two CXXC motifs. The bound metal (zinc or iron) may stabilize the conformation of the enzymes.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03036
Size 100 µg
Host E.coli
Accession
Molecular Weight 17.6 kDa (157aa) confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMANKPSAEELKKNLSEMQFYVTQNHGTEPPFTGRLLHNKRDGVYHCLICDAPLFHSQTKYDSGCGWPSFYEPVSEESIRYIKDLSHGMQRIEIRCGNCDAHLGHVFPDGPQPTGERYCVNSASLRFTDGENGEEING
Purity > 95% by HPLC
Concentration 1.0 mg/ml (determined by Bradford assay)
Formulation Liquid. 20mM Tris-HCl buffer (pH8.0) containing 20% glycerol 0.1M NaCl,1mM DTT
Other Names Methionine sulfoxide reductase B, ECK1776, JW1767, yeaA
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap