MSRA, 24-235aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
MSRA (methionine sulfoxide reductase A ) belongs to the MsrA Met sulfoxide reductase family. This enzyme has an important function as a repair enzyme for proteins that have been inactivated by oxidation. It catalyzes the reversible oxidation-reduction of methionine sulfoxide in proteins to methionine. In enzymology, a MSRA is an enzyme that catalyzes the chemical reaction.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03035
Size 100 µg
Host E.coli
Accession
Molecular Weight 26.2kDa (237aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSHMGNSASNIVSPQEALPGRKEQTPVAAKHHVNGNRTVEPFPEGTQMAVFGMGCFWGAERKFWVLKGVYSTQVGFAGGYTSNPTYKEVCSEKTGHAEVVRVVYQPEHMSFEELLKVFWENHDPTQGMRQGNDHGTQYRSAIYPTSAKQMEAALSSKENYQKVLSEHGFGPITTDIREGQTFYYAEDYHQQYLSKNPNGYCGLGGTGVSCPVGIKK
Purity > 95% by HPLC
Concentration 0.5mg/ml (determined by Bradford assay)
Formulation Liquid. In 20 mM Tris-HCl buffer, pH8.0, 10% glycerol, 1mM DTT, 50mM NaCl
Other Names Methionine sulfoxide reductase A, bA235O14.2, NRK1, RP11-235O14.2.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap