Home / Products / proteins / msrA, 1-212aa, E.coli, His tag, E.coli

msrA, 1-212aa, E.coli, His tag, E.coli

Categories: [Proteins / Peptides]
Peptide methionine sulfoxide reductase A, also known msrA, is an enzyme that catalyzes the reversible oxidation-reduction of methionine sulfoxide in proteins to methionine. This protein could have an important function as a repair enzyme for proteins that have been inactivated by oxidation. Recombinant E.coli msrA protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03034
Size 10 µg
Host E.coli
Accession
Molecular Weight 25.4 kDa (232aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMSLFDKKHLVSPADALPGRNTPMPVATLHAVNGHSMTNVPDGMEIAIFAMGCFWGVERLFWQLPGVYSTAAGYTGGYTPNPTYREVCSGDTGHAEAVRIVYDPSVISYEQLLQVFWENHDPAQGMRQGNDHGTQYRSAIYPLTPEQDAAARASLERFQAAMLAADDDRHITTEIANATPFYYAEDDHQQYLHKNPYGYCGIGGIGVCLPPEA
Purity > 95% by HPLC
Concentration 0.5 mg/ml (determined by Bradford assay )
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 1mM DTT, 10% glycerol, 0.1M NaCl
Other Names Peptide methionine sulfoxide reductase A, ECK4215, JW4178, pms, pmsR, peptide-methionine (S)-S-oxide reductase
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap