Home / Products / proteins / MRRF, 56-262aa, Human, His tag, E.coli

MRRF, 56-262aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
MRRF binds to the large ribosomal subunit in the cleft that contains the peptidyl transferase center. This protein is responsible for the release of ribosome from messenger RNA at the termination of protein biosynthesis. Also, it may increase the efficiency of translation by recycling ribosome from one round of translation to another. Recombinant human MRRF protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03030
Size 100 µg
Host E.coli
Accession
Molecular Weight 25.1 kDa (228aa) confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMATKKAKAKGKGQSQTRVNINAALVEDIINLEEVNEEMKSVIEALKDNFNKTLNIRTSPGSLDKIAVVTADGKLALNQISQISMKSPQLILVNMASFPECTAAAIKAIRESGMNLNPEVEGTLIRVPIPQVTREHREMLVKLAKQNTNKAKDSLRKVRTNSMNKLKKSKDTVSEDTIRLIEKQISQMADDTVAELDRHLAVKTKELLG
Purity > 95% by HPLC
Concentration 0.5mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 0.2M NaCl, 30% glycerol,2mM DTT
Other Names Ribosome-recycling factor, mitochondrial isoform 1, MRFF, MTRRF, RRF
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap