Home / Products / proteins / MRPS25, 1-173aa, Human, His tag, E.coli

MRPS25, 1-173aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
MRPS25 is a 28S subunit protein that belongs to the ribosomal protein S5P family. A pseudogene corresponding to this gene is found on chromosome 4. Recombinant human MRPS25 protein, fused to His-tag at N-terminus, was expressed in E.coli .
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03028
Size 100 µg
Host E.coli
Accession
Molecular Weight 22.5kDa (196aa)
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSMPMKGRFPIRRTLQYLSQGNVVFKDSVKVMTVNYNTHGELGEGARKFVFFNIPQIQYKNPWVQIMMFKNMTPSPFLRFYLDSGEQVLVDVETKSNKEIMEHIRKILGKNEETLREEEEEKKQLSHPANFGPRKYCLRECICEVEGQVPCPSLVPLPKEMRGKYKAALKADAQD
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing, 10% glycerol, 0.4M Urea
Other Names 28S ribosomal protein S25, mitochondrial, mitochondrial ribosomal protein S25, MRP-S25, RPMS25
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap