MRPL1, 51-325aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
39S ribosomal protein L1, mitochondrial precursor, also known as MRPL1, is a 338 amino acid mitochondrial protein that exists as a component of the 39S ribosomal subunit and works in conjunction with other MRPs to mediate protein synthesis. Mitochondrial ribosomes consist of a large 39S subunit and a small 28S subunit, both of which are comprised of multiple mitochondrial ribosomal proteins (MRPs) that are encoded by nuclear genes and are essential for protein synthesis within mitochondria. MRPL1 exists as two isoforms produced by alternative splicing. Isoform one of MRPL1 is ubiquitously expressed while isoform two is specifically expressed in heart. Recombinant human MRPL1 proteinto His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $487
  • Buy 5 for $462.65 each and save 5%
  • Buy 21 for $438.3 each and save 10%
  • Buy 31 for $413.95 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03021
Size 100 µg
Host E.coli
Accession
Molecular Weight 33.8kDa (298aa) confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSKKTKKGAKEKTPDEKKDEIEKIKAYPYMEGEPEDDVYLKRLYPRQIYEVEKAVHLLKKFQILDFTSPKQSVYLDLTLDMALGKKKNVEPFTSVLSLPYPFASEINKVAVFTENASEVKIAEENGAAFAGGTSLIQKIWDDEIVADFYVAVPEIMPELNRLRKKLNKKYPKLSRNSIGRDIPKMLELFKNGHEIKVDEERENFLQTKIATLDMSSDQIAANLQAVINEVCRHRPLNLGPFVVRAFLRSSTSEGLLLKIDPLLPKEVKNEESEKEDA
Purity > 95% by HPLC
Concentration 0.5 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 0.1M NaCl, 30% glycerol, 1mM DTT
Other Names 39S ribosomal protein L1, mitochondrial precursor , BM022, L1MT, MRP-L1
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap