Home / Products / proteins / MORF4L2, 1-288aa, Human, His tag, E.coli

MORF4L2, 1-288aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
MORF4L2 is a member of the mortality factor (MORF) family of transcriptional regulator that is involved in cell growth, regulation and senescence. This protein localizes to the nucleus, and it has a protein kinase C phosphorylation site as well as a tyrosine phosphorylation site. It interacts with the Rb tumor suppressor through its helix-loop-helix and leucine zipper regions. It also has histone deacetylase activity and can either repress or promote the activity of the B-Myb promoter depending on the tissue.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03008
Size 100 µg
Host E.coli
Accession
Molecular Weight 34.4 kDa (308aa) confirmed by MALDI-TOF (Molecular weight on SDS-PAGE will appear higher)
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMSSRKQGSQPRGQQSAEEENFKKPTRSNMQRSKMRGASSGKKTAGPQQKNLEPALPGRWGGRSAENPPSGSVRKTRKNKQKTPGNGDGGSTSEAPQPPRKKRARADPTVESEEAFKNRMEVKVKIPEELKPWLVEDWDLVTRQKQLFQLPAKKNVDAILEEYANCKKSQGNVDNKEYAVNEVVAGIKEYFNVMLGTQLLYKFERPQYAEILLAHPDAPMSQVYGAPHLLRLFVRIGAMLAYTPLDEKSLALLLGYLHDFLKYLAKNSASLFTASDYKVASAEYHRKAL
Purity > 95% by HPLC
Concentration 0.5 mg/ml (determined by Bradford assay)
Formulation Liquid. 20mM Tris-HCl buffer (pH8.0) containing 20% glycerol 1mM DTT
Other Names Mortality factor 4-like protein 2, KIAA0026, MORFL2, MRGX
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap