Home / Products / proteins / MOBKL3, 1-225aa, Human, His tag, E.coli

MOBKL3, 1-225aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
Mps one binder kinase activator-like 3, also known as MOBKL3, belongs to the MOB1/Phocein family and is phosphorylated on serine residues. It is usually associated with membranes but can be present in the cytosol, where it behaves as a protein complex. It is the major partner of the striatin family members, which are scaffolding proteins involved in signaling and trafficking.
List Price: $414
  • Buy 5 for $393.3 each and save 5%
  • Buy 21 for $372.6 each and save 10%
  • Buy 31 for $351.9 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03005
Size 50 μg
Host E.coli
Accession
Molecular Weight 28.1 kDa (245aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMVMAEGTAVLRRNRPGTKAQDFYNWPDESFDEMDSTLAVQQYIQQNIRADCSNIDKILEPPEGQDEGVWKYEHLRQFCLELNGLAVKLQSECHPDTCTQMTATEQWIFLCAAHKTPKECPAIDYTRHTLDGAACLLNSNKYFPSRVSIKESSVAKLGSVCRRIYRIFSHAYFHHRQIFDEYENETFLCHRFTKFVMKYNLMSKDNLIVPILEEEVQNSVSGESEA
Purity > 95% by HPLC
Concentration 0.5 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20 mM Tris-HCl buffer (pH8.0) containing 0.2M Nacl,5mM DTT, 10% glycerol
Other Names Mps one binder kinase activator-like 3, MOB1, MOB3, PREI3, CGI-95
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap