MMP7, 95-267aa , Human, His tag, E.coli

Categories: [Proteins / Peptides]
MMP7 also known as Matrilysin. MMP7 belongs to the matrix metalloproteinase (MMP) family, which are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. MMP7 protein enhanced the phosphorylation of p38 and ERK mitogen-activated protein kinases. MMP7 has directly functional target of miR-148a, participating in cell invasion. Recombinant human MMP7 was expressed in E.coli.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02998
Size 100 µg
Host E.coli
Accession
Molecular Weight 19.2kDa (174aa)
AP_Mol_Weight
Tag N-6His
Sequences MYSLFPNSPKWTSKVVTYRIVSYTRDLPHITVDRLVSKALNMWGKEIPLHFRKVVWGTADIMIGFARGAHGDSYPFDGPGNTLAHAFAPGTGLGGDAHFDEDERWTDGSSLGINFLYAATHELGHSLGMGHSSDPNAVMYPTYGNGDPQNFKLSQDDIKGIQKLYGKRSNSRKK
Purity > 95% by HPLC
Concentration 1mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris 8.0 containing 10% glycerol
Other Names Matrilysin , MMP-7, MPSL1, PUMP-1
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap