MMP1, 18-469aa, Human, His-tag, Baculovirus

Categories: [Proteins / Peptides]
MMP1, also known as interstitial collagenase isoform 1, contains 4 hemopexin-like domains and is a member of the matrix metalloproteinase (MMP) family. It is capable of degrading a wide range of extracellular molecules and a number of bioactive molecules. It plays a central role in cell proliferation, migration, differentiation, angiogenesis, apoptosis and host defences. Recombinant human MMP1, fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
List Price: $302
  • Buy 5 for $286.9 each and save 5%
  • Buy 21 for $271.8 each and save 10%
  • Buy 31 for $256.7 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02990
Size 50 µg
Host Baculovirus
Accession
Molecular Weight 53.1kDa (460aa), 50-70kDa (SDS-PAGE under reducing conditions)
AP_Mol_Weight
Tag
Sequences HSFPATLETQEQDVDLVQKYLEKYYNLKNDGRQVEKRRNSGPVVEKLKQMQEFFGLKVTGKPDAETLKVMKQPRCGVPDVAQFVLTEGNPRWEQTHLTYRIENYTPDLPRADVDHAIEKAFQLWSNVTPLTFTKVSEGQADIMISFVRGDHRDNSPFDGPGGNLAHAFQPGPGIGGDAHFDEDERWTNNFREYNLHRVAAHELGHSLGLSHSTDIGALMYPSYTFSGDVQLAQDDIDGIQAIYGRSQNPVQPIGPQTPKACDSKLTFDAITTIRGEVMFFKDRFYMRTNPFYPEVELNFISVFWPQLPNGLEAAYEFADRDEVRFFKGNKYWAVQGQNVLHGYPKDIYSSFGFPRTVKHIDAALSEENTGKTYFFVANKYWRYDEYKRSMDPGYPKMIAHDFPGIGHKVDAVFMKDGFFYFFHGTRQYKFDPKTKRILTLQKANSWFNCRKNLEHHHHHH
Purity > 95% by HPLC
Concentration 0.25mg/ml (determined by Absorbance at 280nm)
Formulation Liquid. In 20mM MES buffer (pH 5.5) containing 10mM CaCl2, 100 mM NaCl, 0.05% Brij35, 30% glycerol.
Other Names Interstitial collagenase isoform 1, MMP1, CLG, CLGN.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap