Home / Products / proteins / MIF (amino acids 1-115) Human,Recombinant, His-tag, E.coli

MIF (amino acids 1-115) Human,Recombinant, His-tag, E.coli

Categories: [Proteins / Peptides]
The cytokine Macrophage migration inhibitory factor (MIF) has been identified to be secreted by the pituitary gland and the monocyte/macrophage and to play an important role in endotoxic shock. MIF has the unique property of being released from macrophages and T cells in response to physiological concentrations of glucocorticoids. The secretion of MIF is tightly regulated and decreases at high, anti-inflammatory steroid concentration.
List Price: $248
  • Buy 5 for $235.6 each and save 5%
  • Buy 21 for $223.2 each and save 10%
  • Buy 31 for $210.8 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02973
Size 100 µg
Host E.coli
Accession
Molecular Weight 16.6 kDa (151 aa)
AP_Mol_Weight
Tag
Sequences MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSMPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In phosphate-buffered saline (PBS), pH 7.4
Other Names Macrophage migration inhibitory factor, Glycosylation inhibiting factor (GIF), GLIF, MMIF
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap