Home / Products / proteins / MICA, 24-297aa, Human, His tag, E.coli

MICA, 24-297aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
MICA also known as MHC class I polypeptide-related sequence A. This Protein’s Function seems to have no role in antigen presentation. It acts as a stress-induced self-antigen that is recognized by gamma delta T-cells. It binding to KLRK1 leads to cell lysis. Recombinant human MICA, fused to His-tag at C-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $414
  • Buy 5 for $393.3 each and save 5%
  • Buy 21 for $372.6 each and save 10%
  • Buy 31 for $351.9 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02970
Size 50 µg
Host E.coli
Accession
Molecular Weight 32.7kDa (283aa) confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MEPHSLRYNLTVLSWDGSVQSGFLTEVHLDGQPFLRCDRQKCRAKPQGQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNSTRSSQHFYYDGELFLSQNLETEEWTMPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMHADCLQELRRYLKSGVVLRRTVPPMVNVTRSEASEGNITVTCRASGFYPWNITLSWRQDGVSLSHDTQQWGDVLPDGNGTYQTWVATRICQGEEQRFTCYMEHSGNHSTHPVPSLEHHHHHH
Purity > 95% by HPLC
Concentration 0.25mg/ml (determined by Bradford assay)
Formulation Liquid, In Phosphate buffered saline (pH7.4) containing 10% glycerol, 1mM DTT.
Other Names MHC class I polypeptide-related sequence A, PERB11.1, truncated.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap