Home / Products / proteins / mgMT, 1-207aa, Human, His-tagged, Recombinant, E.coli

mgMT, 1-207aa, Human, His-tagged, Recombinant, E.coli

Categories: [Proteins / Peptides]
O-6-methylguanine-DNA methyltransferase (MGMT) is an enzyme that repairsO-6-methylguanine, amutagenic DNA base damaged by endogenous and environmental alkylating agents and is involved in the cellular defense against the biological effects of O-6-methylguanine in DNA. MGMT repairs alkylated guanine in DNA by stoichiometrically transferring the alkyl group at the O-6 position to a cysteine residue in the enzyme.
List Price: $473
  • Buy 5 for $449.35 each and save 5%
  • Buy 21 for $425.7 each and save 10%
  • Buy 31 for $402.05 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02967
Size 100 µg
Host E.coli
Accession
Molecular Weight 23.8 kDa (227 aa) (Real molecular weight on SDS-PAGE will be shift up)
AP_Mol_Weight
Tag
Sequences MGSSHHHHHHSSGLVPRGSHMDKDCEMKRTTLDSPLGKLELSGCEQGLHEIKLLGKGTSAADAVEVPAPAAVLGGPEPLMQCTAWLNAYFHQPEAIEEFPVPAFHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAALAGNPKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGGLAVKEWLLAHEGHRLGKPGLGGSSGLAGAWLKGAGATSGSPPAGRN
Purity > 95% by HPLC
Concentration 0.5 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20 mM Tris-HCl buffer (pH 7.5) containing 1 mM DTT,10% glycerol
Other Names O-6-methylguanine-DNA methyltransferase
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap