Home / Products / proteins / MFAP2, 18-183aa, Human, His tag, E.coli

MFAP2, 18-183aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
Microfibrillar-associated protein 2, also known as MFAP2, is an O-glycosylated protein secreted to the extracellular space and the extracellular matrix. MFAP2 associates with biglycan and elastin in a ternary complex. It is shown to play a significant role in the support and distensibility of the juxtacanalicular region of these collector channels.
List Price: $414
  • Buy 5 for $393.3 each and save 5%
  • Buy 21 for $372.6 each and save 10%
  • Buy 31 for $351.9 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02958
Size 50 µg
Host E.coli
Accession
Molecular Weight 21.5 kDa (190aa)
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSMQGQYDLDPLPPFPDHVQYTHYSDQIDNPDYYDYQEVTPRPSEEQFQFQSQQQVQQEVIPAPTPEPGNAELEPTEPGPLDCREEQYPCTRLYSIHRPCKQCLNEVCFYSLRRVYVINKEICVRTVCAHEELLRADLCRDKFSKCGVMASSGLCQSVAASCARSCGSC
Purity > 95% by HPLC
Concentration 0.5 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 1M Urea, 20% glycerol
Other Names Microfibrillar-associated protein 2, Microfibrillar-associated protein 2, MAGP, MAGP-1, MAGP1
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap