METTL1, 1-276aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
METTL1 is known as tRNA (guanine-N(7)-)-methyltransferase which belongs to the methyltransferase superfamily. METTL1 shows high sequence similarity to yeast ORF YDL201w and has been shown to be inactivated by phosphorylation. This protein contains a conserved S-adenosylmethionine-binding motif and is inactivated by phosphylation. It catalyzes the formation of N(7)-methylguanine at position 46 (m7G46) in tRNA.
List Price: $414
  • Buy 5 for $393.3 each and save 5%
  • Buy 21 for $372.6 each and save 10%
  • Buy 31 for $351.9 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02956
Size 50 µg
Host E.coli
Accession
Molecular Weight 33.6kDa (296aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMAAETRNVAGAEAPPPQKRYYRQRAHSNPMADHTLRYPVKPEEMDWSELYPEFFAPLTQNQSHDDPKDKKEKRAQAQVEFADIGCGYGGLLVELSPLFPDTLILGLEIRVKVSDYVQDRIRALRAAPAGGFQNIACLRSNAMKHLPNFFYKGQLTKMFFLFPDPHFKRTKHKWRIISPTLLAEYAYVLRVGGLVYTITDVLELHDWMCTHFEEHPLFERVPLEDLSEDPVVGHLGTSTEEGKKVLRNGGKNFPAIFRRIQDPVLQAVTSQTSLPGH
Purity > 95% by HPLC
Concentration 0.5 mg/ml (determined by Bradford assay)
Formulation Liquid. 20mM Tris-HCl buffer (pH8.0) containing 10% glycerol,1mM DTT, 50mM NaCl
Other Names Methyltransferase like 1, TRM8, YDL201w
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap